PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG007074t1
Common NameTCM_007074
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 424aa    MW: 46168.9 Da    PI: 9.8149
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG007074t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14347399557
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+ ee+ ++ +
  Thecc1EG007074t1 347 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNQELQKKQEEMMEMQK 399
                       79*****************************************9999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12343407IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875345396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-14347397No hitNo description
PfamPF001701.2E-12347399IPR004827Basic-leucine zipper domain
CDDcd147071.03E-25347401No hitNo description
SuperFamilySSF579594.56E-10347397No hitNo description
PROSITE patternPS000360350365IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MGSHLNYKNF GDAPSMEGNG SKPLGNFPLA RQSSIYSLTF DELQNTFGGL GKDFGSMNMD  60
ELLKNISTAE ETQAVTTASV AGGEGSFSGG NLQRQGSLTL PRTLSQKTVD EVWRDLMKEN  120
DGAKDGSNGG GVGGGASLPQ RQQTLGEMTL EEFLVRAGVV REDMQQIGMA NNSGFFGNNT  180
GVALGFQQTN RNNGFLSNNN SVLNHPPRLP LNMSGVKSSQ PQQQQQQQQQ QQPQQQQQQQ  240
PQPLFPKQQT VAFAPSMHLM NTAQLANPGV RGSMVGIGDP SMNSNLVQST GLQSGGMGIV  300
GLASPPSQIS SDMIPNNSVD ATSLSPVPYV FGRGRKCSAA LEKVVERRQR RMIKNRESAA  360
RSRARKQAYT LELEAEVAKL KEMNQELQKK QEEMMEMQKN QMLETMSRPC KRHCLRRTLT  420
GPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042439.10.0Abscisic acid responsive element-binding factor 1, putative isoform 1
RefseqXP_007042440.10.0Abscisic acid responsive element-binding factor 1, putative isoform 1
SwissprotQ9M7Q31e-128AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A061DZZ40.0A0A061DZZ4_THECC; Abscisic acid responsive element-binding factor 1, putative isoform 1
STRINGVIT_03s0063g00310.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.17e-89abscisic acid responsive element-binding factor 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]